PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CA10g17560
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Capsiceae; Capsicum
Family NF-YA
Protein Properties Length: 204aa    MW: 22585.7 Da    PI: 10.4255
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CA10g17560genomePEPView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA85.96e-273993258
   CBFB_NFYA  2 eplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
                 p++VNaKQy++Il+RR+ Rak e e+kl  k rkp+lh SRh hA+rRpRg gGrF
  CA10g17560 39 TPIFVNAKQYHGILRRRKLRAK-EMENKL-LKPRKPFLHLSRHLHAMRRPRGGGGRF 93
                7********************9.566999.9*************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005213.5E-303696IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115231.2783796IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.9E-204062IPR001289Nuclear transcription factor Y subunit A
PfamPF020452.8E-234093IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.9E-207093IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MSSLSMQSYN VDYQGHFYQC FGQPLGRIML PLNLTSDETP IFVNAKQYHG ILRRRKLRAK  60
EMENKLLKPR KPFLHLSRHL HAMRRPRGGG GRFLNTRKAN GSMNNDANGT TKTSNMKCHP  120
TGSQISDISS FNSPKETTNR MSCNSSEVTS LYSRGSSFGT FPTHNSPSVD AFIDMMNTGH  180
DDILMASKWG SAAAASSCCN LKI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A1e-1638106271NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2547632e-52AC254763.4 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone slm-63a14 map 10, complete sequence.
GenBankHG9755222e-52HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016555012.11e-153PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_016555013.11e-153PREDICTED: nuclear transcription factor Y subunit A-4-like
RefseqXP_016555014.11e-153PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLM1CQ292e-87M1CQ29_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000723226e-87(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37062347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.32e-31nuclear factor Y, subunit A10